PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 460aa    MW: 50118 Da    PI: 6.3032
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018073.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.81.9e-074778536
     zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg 36
                  C++++ +++++ C d ++ lC++C  ++H +
  Pbr018073.1 47 LCDKCNAQPAIIRCMDEKTSLCQSCDHWSHTN 78
                 6*****************************76 PP

2CCT63.27.8e-22403446144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYkeK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  Pbr018073.1 403 RDKAKMRYKEKKKTRTFGKQIRYASRKARADTRKRVKGRFVKAG 446
                  899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.503147IPR000315B-box-type zinc finger
SMARTSM003367.4E-8147IPR000315B-box-type zinc finger
CDDcd000212.41E-5347No hitNo description
PfamPF062031.2E-16403445IPR010402CCT domain
PROSITE profilePS5101714.981403445IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MEPLCEFCGM AMAVVYCKSD MARLCLYCDG CVHSANALSR RHPRFLLCDK CNAQPAIIRC  60
MDEKTSLCQS CDHWSHTNTS INGITTAAAG GGMGGHRTHA LTCYTGCPSL SEFSRIWSVL  120
EGSSSSGGNF ESSNWDQSLG SAVVATNQDQ TNYISNNGLE GRDNNDRSFG VVVTAGKLNG  180
GSSLDQSCGR KFDTWIASSS TLLPSNPNCT THGKDQTPFL PQESSLPKGC TNFKDLAIQD  240
SNVLSDGLNV DDVPLTFENP DGIFCPQVPS RYQFEDRLDR EMDCLLMEKS LSVTESNGPK  300
ENAAQASSSG QQERAAFQSS CGSDTVMPGM NGSANCLLMN PTCSRSINLG FPTVQQVHPS  360
MSLTLPSISR ESNPDYQDCE LSTVFLTGEP WESTLEASSP QARDKAKMRY KEKKKTRTFG  420
KQIRYASRKA RADTRKRVKG RFVKAGEEYD YDPLVTTSF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353242.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12
TrEMBLM5XFT80.0M5XFT8_PRUPE; Uncharacterized protein
STRINGGLYMA12G32221.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70521923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.14e-73B-box type zinc finger protein with CCT domain